
Atlas Antibodies Anti-RUVBL1 Antibody
상품 한눈에 보기
Atlas Antibodies의 Anti-RUVBL1 항체는 인간 RUVBL1 단백질을 표적하는 고품질 폴리클로날 항체입니다. IHC 및 WB에서 유전자 기반 검증 완료. Rabbit 유래 IgG, Affinity purified. 인체, 생쥐, 랫트에서 높은 교차 반응성 확인.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RUVBL1 Antibody
Target Protein: RuvB-like AAA ATPase 1
Supplier: Atlas Antibodies
Recommended Applications
- IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB Genetic Validation: Genetic validation in WB by siRNA knockdown.
- ICC: Validated for immunocytochemistry.
Product Description
Polyclonal antibody against Human RUVBL1
Alternative Gene Names
ECP54, INO80H, NMP238, Pontin52, RVB1, TIH1, TIP49, TIP49a
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | RuvB-like AAA ATPase 1 |
| Target Gene | RUVBL1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDV |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000013195 (100%), Mouse ENSMUSG00000030079 (100%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet
Open Datasheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-RUVBL1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RUVBL2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RUVBL1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RUNX3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RUSC2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.