CacheBy
Atlas Antibodies Anti-RTCA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RTCA Antibody

상품 한눈에 보기

Human RTCA 단백질을 표적으로 하는 rabbit polyclonal antibody로, IHC, WB, ICC 분석에 적합합니다. RTCA의 RNA 3'-terminal phosphate cyclase 단백질 발현 검증에 사용되며, 높은 종간 반응성과 높은 특이성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028151-100 Anti-RTCA Antibody, RNA 3`-terminal phosphate cyclase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028151-25 Anti-RTCA Antibody, RNA 3`-terminal phosphate cyclase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RTCA Antibody

Anti-RTCA Antibody

RNA 3'-terminal phosphate cyclase


  • Immunohistochemistry (IHC)
  • Western Blot (WB, Independent validation)
  • Immunocytochemistry (ICC)

Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal antibody against Human RTCA.


Alternative Gene Names

RPC, RTC1, RTCD1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein RNA 3'-terminal phosphate cyclase
Target Gene RTCA
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LFAASPSELHLKGGTNAEMAPQIDYTVMVFKPIVEKFGFIFNCDIKTRGYYPKGGGEVIVRMSPVKQLNPINLTERGCVTKIY
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Rat (90%), Mouse (89%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Validation
Independent Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.