Atlas Antibodies Anti-RTCA Antibody

상품 한눈에 보기

Human RTCA 단백질을 표적으로 하는 rabbit polyclonal antibody로, IHC, WB, ICC 분석에 적합합니다. RTCA의 RNA 3'-terminal phosphate cyclase 단백질 발현 검증에 사용되며, 높은 종간 반응성과 높은 특이성을 제공합니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA028151-100 Anti-RTCA Antibody, RNA 3`-terminal phosphate cyclase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA028151-25 Anti-RTCA Antibody, RNA 3`-terminal phosphate cyclase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-RTCA Antibody

Anti-RTCA Antibody

RNA 3'-terminal phosphate cyclase

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB, Independent validation)
Immunocytochemistry (ICC)

Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody against Human RTCA.

Alternative Gene Names

RPC, RTC1, RTCD1

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	RNA 3'-terminal phosphate cyclase
Target Gene	RTCA
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	LFAASPSELHLKGGTNAEMAPQIDYTVMVFKPIVEKFGFIFNCDIKTRGYYPKGGGEVIVRMSPVKQLNPINLTERGCVTKIY
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Identity	Rat (90%), Mouse (89%)