AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-RSBN1L Antibody
상품 한눈에 보기
Human RSBN1L 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC에 적합하며 Human, Mouse, Rat에서 반응. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 연구용으로 다양한 단백질 발현 분석에 활용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA020406-100 Anti-RSBN1L Antibody, round spermatid basic protein 1-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020406-25 Anti-RSBN1L Antibody, round spermatid basic protein 1-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-RSBN1L Antibody
Anti-RSBN1L Antibody
Target: round spermatid basic protein 1-like (RSBN1L)
Type: Polyclonal Antibody against Human RSBN1L
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against Human RSBN1L protein.
Alternative Gene Names
FLJ42526, FLJ45813, MGC71764
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | round spermatid basic protein 1-like |
| Target Gene | RSBN1L |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | KRPKMYSKSIQTICSGLLTDVEDQAAKGILNDNIKDYVGKNLDTKNYDSKIPENSEFPFVSLKEPRVQNNLKRLDTLEFKQLIHIEHQPNGGASVIHAYSNELSHLS |
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
Highest antigen sequence identity to orthologs:
- Rat ENSRNOG00000013431 (84%)
- Mouse ENSMUSG00000039968 (82%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.