
Atlas Antibodies Anti-RSBN1L Antibody
상품 한눈에 보기
Human RSBN1L 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC에 적합하며 Human, Mouse, Rat에서 반응. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 연구용으로 다양한 단백질 발현 분석에 활용 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RSBN1L Antibody
Target: round spermatid basic protein 1-like (RSBN1L)
Type: Polyclonal Antibody against Human RSBN1L
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against Human RSBN1L protein.
Alternative Gene Names
FLJ42526, FLJ45813, MGC71764
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | round spermatid basic protein 1-like |
| Target Gene | RSBN1L |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | KRPKMYSKSIQTICSGLLTDVEDQAAKGILNDNIKDYVGKNLDTKNYDSKIPENSEFPFVSLKEPRVQNNLKRLDTLEFKQLIHIEHQPNGGASVIHAYSNELSHLS |
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
Highest antigen sequence identity to orthologs:
- Rat ENSRNOG00000013431 (84%)
- Mouse ENSMUSG00000039968 (82%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-RSAD2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RSAD1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RSBN1L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RSAD2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RSBN1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.