
Atlas Antibodies Anti-RPS6KB2 Antibody
상품 한눈에 보기
인간 RPS6KB2 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC 및 WB 응용에 적합. 고순도 친화성 정제 방식으로 제조. 인간, 마우스, 랫트 반응성 검증 완료.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RPS6KB2 Antibody
Target: ribosomal protein S6 kinase, 70kDa, polypeptide 2
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human RPS6KB2.
Alternative Gene Names
KLS, P70-BETA, p70S6Kb, STK14B
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ribosomal protein S6 kinase, 70kDa, polypeptide 2 |
| Target Gene | RPS6KB2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | VDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRAPVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPPPPPSTTAPLPIRPPSGTKK |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Rat ENSRNOG00000021689 (89%), Mouse ENSMUSG00000097721 (88%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-RPTOR Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RPTN Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RPS6KB2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RPS6KB1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RPS6KC1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.