
Atlas Antibodies Anti-RPS5 Antibody
상품 한눈에 보기
Human RPS5 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 사용 가능. 독립적 항체 검증을 통해 높은 특이성과 신뢰성 확보. Affinity purified 방식으로 정제되어 안정적이고 재현성 높은 결과 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RPS5 Antibody
Target: ribosomal protein S5
Recommended Applications
- IHC (Immunohistochemistry)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. - WB (Western Blot)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. - ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human RPS5
Alternative Gene Names
- S5
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ribosomal protein S5 |
| Target Gene | RPS5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MTEWETAAPAVAETPDIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAAKRFRKA |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000019453 (98%), Mouse ENSMUSG00000012848 (97%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-RPS6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RPS6KA5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RPS5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RPS6KA3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RPS6KA1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.