
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-RPS5 Antibody
상품 한눈에 보기
Human RPS5 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 사용 가능. 독립적 항체 검증을 통해 높은 특이성과 신뢰성 확보. Affinity purified 방식으로 정제되어 안정적이고 재현성 높은 결과 제공.
- 카탈로그번호
- HPA061979-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA061979-100 Anti-RPS5 Antibody, ribosomal protein S5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061979-25 Anti-RPS5 Antibody, ribosomal protein S5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-RPS5 Antibody
Anti-RPS5 Antibody
Target: ribosomal protein S5
Recommended Applications
- IHC (Immunohistochemistry)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. - WB (Western Blot)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. - ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human RPS5
Alternative Gene Names
- S5
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ribosomal protein S5 |
| Target Gene | RPS5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MTEWETAAPAVAETPDIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAAKRFRKA |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000019453 (98%), Mouse ENSMUSG00000012848 (97%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



