
Atlas Antibodies Anti-RPS3A Antibody
상품 한눈에 보기
인간 RPS3A 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 가집니다. 단백질 발현 검증에 활용 가능합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RPS3A Antibody
Target: ribosomal protein S3A
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. - Immunocytochemistry (ICC)
Product Description
Polyclonal Antibody against Human RPS3A
Alternative Gene Names
MFTL, S3A
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ribosomal protein S3A |
| Target Gene | RPS3A |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | QGTKIASDGLKGRVFEVSLADLQNDEVAFRKFKLITEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTT |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000048109 (100%), Mouse ENSMUSG00000028081 (100%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-RPS27L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RPS28 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RPS3A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RPS3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RPS26 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.