Atlas Antibodies Anti-RPS25 Antibody

상품 한눈에 보기

Human RPS25 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. 높은 종간 반응성(인간, 생쥐, 랫드)과 특이적 에피토프 기반 정제 방식을 제공합니다. 40% 글리세롤/PBS 완충액에 보존되어 안정적입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA078683-100 Anti-RPS25 Antibody, ribosomal protein S25 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA078683-25 Anti-RPS25 Antibody, ribosomal protein S25 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Ribosomal protein S25
Type: Polyclonal Antibody against Human RPS25

Polyclonal antibody raised in rabbit against human RPS25.

항목	내용
Target Protein	Ribosomal protein S25
Target Gene	RPS25
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	VPNYKLITPAVVSERLKIRGSLARAALQELLSKGLIKLVSKHRAQVIYTRNTKGGDAPAAGEDA

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand