CacheBy
Atlas Antibodies Anti-RPS15 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RPS15 Antibody

상품 한눈에 보기

인간 RPS15 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC에서 독립 검증 완료. 토끼 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. 인간 및 설치류 종에 100% 반응성 확인. PBS와 글리세롤 버퍼에 보존.

카탈로그번호
HPA054510-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA054510-100 Anti-RPS15 Antibody, ribosomal protein S15 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054510-25 Anti-RPS15 Antibody, ribosomal protein S15 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RPS15 Antibody

Anti-RPS15 Antibody

Target Information

  • Target Protein: Ribosomal protein S15
  • Target Gene: RPS15
  • Alternative Gene Names: MGC111130, RIG, S15

Product Description

Polyclonal antibody against human RPS15.

  • IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Independent Validation): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
  • ICC: Suitable for immunocytochemistry.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

MAEVEQKKKRTFRKFTYRGVDLDQLLDMSYEQLMQLYSARQRRRLNRGLRRKQH

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|----------|----------|-----------|
| Rat | ENSRNOG00000024603 | 100% |
| Mouse | ENSMUSG00000063457 | 100% |

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

Component Description
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지

Enhanced Validation
IHC Independent Validation
WB Independent Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.