Atlas Antibodies Anti-RPS13 Antibody

상품 한눈에 보기

Human RPS13 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 실험에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 반응하며, Mouse 및 Rat과 100% 서열 동일성을 가집니다.

카탈로그번호: HPA005985-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA005985-100 Anti-RPS13 Antibody, ribosomal protein S13 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA005985-25 Anti-RPS13 Antibody, ribosomal protein S13 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-RPS13 Antibody

Anti-RPS13 Antibody

Target: ribosomal protein S13
Type: Polyclonal Antibody against Human RPS13

Recommended Applications

Immunohistochemistry (IHC)
Immunocytochemistry (ICC)

Product Description

This polyclonal antibody is raised in rabbit against the human ribosomal protein S13 (RPS13). It is affinity purified using the PrEST antigen as the affinity ligand.

Alternative Gene Names

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	ribosomal protein S13
Target Gene	RPS13
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	RSVPTWLKLTSDDVKEQIYKLAKKGLTPSQIGVILRDSHGVAQVRFVTGNKILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIESRIHRLARYYKTKRVLPPNWKYESSTA
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000090862 (100%), Rat ENSRNOG00000028021 (100%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)