CacheBy
Atlas Antibodies Anti-RPS13 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RPS13 Antibody

상품 한눈에 보기

Human RPS13 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 실험에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 반응하며, Mouse 및 Rat과 100% 서열 동일성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA005985-100 Anti-RPS13 Antibody, ribosomal protein S13 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA005985-25 Anti-RPS13 Antibody, ribosomal protein S13 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RPS13 Antibody

Anti-RPS13 Antibody

Target: ribosomal protein S13
Type: Polyclonal Antibody against Human RPS13


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

This polyclonal antibody is raised in rabbit against the human ribosomal protein S13 (RPS13). It is affinity purified using the PrEST antigen as the affinity ligand.


Alternative Gene Names

  • S13

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein ribosomal protein S13
Target Gene RPS13
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence RSVPTWLKLTSDDVKEQIYKLAKKGLTPSQIGVILRDSHGVAQVRFVTGNKILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIESRIHRLARYYKTKRVLPPNWKYESSTA
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000090862 (100%), Rat ENSRNOG00000028021 (100%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.