
Atlas Antibodies Anti-RPS13 Antibody
상품 한눈에 보기
Human RPS13 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 실험에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 반응하며, Mouse 및 Rat과 100% 서열 동일성을 가집니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RPS13 Antibody
Target: ribosomal protein S13
Type: Polyclonal Antibody against Human RPS13
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
This polyclonal antibody is raised in rabbit against the human ribosomal protein S13 (RPS13). It is affinity purified using the PrEST antigen as the affinity ligand.
Alternative Gene Names
- S13
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ribosomal protein S13 |
| Target Gene | RPS13 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | RSVPTWLKLTSDDVKEQIYKLAKKGLTPSQIGVILRDSHGVAQVRFVTGNKILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIESRIHRLARYYKTKRVLPPNWKYESSTA |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000090862 (100%), Rat ENSRNOG00000028021 (100%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-RPS16 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RPS14 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RPS13 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RPS11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RPRD1B Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.