CacheBy
Atlas Antibodies Anti-RPL37A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RPL37A Antibody

상품 한눈에 보기

인간 RPL37A 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. 토끼에서 유래한 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, 높은 종간 보존성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA065327-100 Anti-RPL37A Antibody, ribosomal protein L37a 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065327-25 Anti-RPL37A Antibody, ribosomal protein L37a 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RPL37A Antibody

Anti-RPL37A Antibody

Target: ribosomal protein L37a (RPL37A)
Type: Polyclonal Antibody against Human RPL37A


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

This polyclonal antibody is generated in rabbit against human RPL37A and is affinity purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

  • L37A

Open Datasheet (PDF)


Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:
KMKRRAVGIWHCGSCVKTVAGGAWTYNTTSAVTVKSAIRRLKELKDQ


Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Identity
Mouse ENSMUSG00000046330 98%
Rat ENSRNOG00000023385 96%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen

Buffer Information

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.