
Atlas Antibodies Anti-RPL27 Antibody
상품 한눈에 보기
Human RPL27 단백질을 인식하는 폴리클로날 항체로 IHC 및 WB에 적합합니다. Rabbit에서 제조되었으며, PrEST 항원을 이용해 친화 정제되었습니다. Human, Mouse, Rat 반응성이 검증되었으며, 안정적인 PBS/glycerol buffer에 보존됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RPL27 Antibody
Target Information
- Target Protein: Ribosomal protein L27
- Target Gene: RPL27
- Alternative Gene Names: L27
Product Description
Polyclonal antibody against human RPL27.
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
GKVVLVLAGRYSGRKAVIVKNIDDGTSDRPYSHALVAGIDRYPRKVTAAMGKKKIAKRSKIKSFVKVYNYNHLMPTRYSVDIPLDKTVVNKDVFRDPALKRKARREAKVKFEERYKTGKN
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000063316 | 100% |
| Rat | ENSRNOG00000020674 | 100% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-RPL27A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RPL27A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RPL27 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RPL19 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RPL26 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.