CacheBy
Atlas Antibodies Anti-RPL27 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RPL27 Antibody

상품 한눈에 보기

Human RPL27 단백질을 인식하는 폴리클로날 항체로 IHC 및 WB에 적합합니다. Rabbit에서 제조되었으며, PrEST 항원을 이용해 친화 정제되었습니다. Human, Mouse, Rat 반응성이 검증되었으며, 안정적인 PBS/glycerol buffer에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA002649-100 Anti-RPL27 Antibody, ribosomal protein L27 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA002649-25 Anti-RPL27 Antibody, ribosomal protein L27 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RPL27 Antibody

Anti-RPL27 Antibody

Target Information

  • Target Protein: Ribosomal protein L27
  • Target Gene: RPL27
  • Alternative Gene Names: L27

Product Description

Polyclonal antibody against human RPL27.

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    GKVVLVLAGRYSGRKAVIVKNIDDGTSDRPYSHALVAGIDRYPRKVTAAMGKKKIAKRSKIKSFVKVYNYNHLMPTRYSVDIPLDKTVVNKDVFRDPALKRKARREAKVKFEERYKTGKN

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000063316 100%
Rat ENSRNOG00000020674 100%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.