CacheBy
Atlas Antibodies Anti-RPL10 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RPL10 Antibody

상품 한눈에 보기

Human RPL10 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. 높은 종 간 보존성을 가지며, PrEST 항원으로 친화 정제되었습니다. 40% glycerol/PBS buffer에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA011311-100 Anti-RPL10 Antibody, ribosomal protein L10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA011311-25 Anti-RPL10 Antibody, ribosomal protein L10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RPL10 Antibody

Anti-RPL10 Antibody

Target: ribosomal protein L10 (RPL10)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal Antibody against Human RPL10.


Alternative Gene Names

DXS648, DXS648E, FLJ23544, L10, NOV, QM

Open Datasheet


Target Information

항목 내용
Target Protein ribosomal protein L10
Target Gene RPL10
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence KMSSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGCGVKYIPSRGPLDKWW

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000056765 97%
Mouse ENSMUSG00000058443 97%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.