CacheBy
Atlas Antibodies Anti-RP11-849H4.2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RP11-849H4.2 Antibody

상품 한눈에 보기

인간 RP11-849H4.2 단백질을 표적하는 폴리클로날 항체로, IHC 및 ICC에 추천됩니다. Rabbit 유래 IgG 형식이며, PrEST 항원으로 친화 정제되었습니다. 인간 반응성이 검증되었으며, 40% glycerol 및 PBS buffer에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA058841-100 Anti-RP11-849H4.2 Antibody, Putative short transient receptor potential channel 2-like protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058841-25 Anti-RP11-849H4.2 Antibody, Putative short transient receptor potential channel 2-like protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RP11-849H4.2 Antibody

Anti-RP11-849H4.2 Antibody

Putative short transient receptor potential channel 2-like protein

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human RP11-849H4.2

Open Datasheet

Target Information

항목 내용
Target Protein Putative short transient receptor potential channel 2-like protein
Target Gene RP11-849H4.2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence QIDVGHSSWPLDRPFITLLPATTLMSLTDSKQGKNRSGVRMFKDGKEGKSRKDGGGLYEKQRCSTKEDCEC

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 일치율
Mouse ENSMUSG00000070425 56%
Rat ENSRNOG00000020188 28%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.