Thermo Fisher Scientific MYOZ1 Polyclonal Antibody
MYOZ1 단백질 검출용 Thermo Fisher Scientific의 토끼 폴리클로날 항체. Western blot에 적합하며 인간 MYOZ1 N-말단 펩타이드(aa 71-120)를 면역원으로 제작됨. 고순도 친화 크로마토그래피 정제, 액상 형태로 제공, -20°C 보관.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific MYOZ1 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.2–1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide directed towards the N-terminal of human MYOZ1 (aa 71–120) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS with 2% sucrose |
| Contains | 0.09% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2577121 |
Product Specific Information
Peptide sequence:
IYENHPDVFSDSSMDHFQKFLPTVGGQLGTAGQGFSYSKSNGRGGSQAGG
Sequence homology:
Cow: 86%
Dog: 100%
Guinea Pig: 100%
Horse: 100%
Human: 100%
Mouse: 100%
Rabbit: 100%
Rat: 100%
Target Information
Sarcomere assembly is regulated by the muscle protein titin. Titin is a giant elastic protein with kinase activity that extends half the length of a sarcomere. It serves as a scaffold to which myofibrils and other muscle-related proteins are attached. This gene encodes a protein found in striated and cardiac muscle that binds to the titin Z1–Z2 domains and is a substrate of titin kinase, interactions thought to be critical to sarcomere assembly. Mutations in this gene are associated with limb-girdle muscular dystrophy type 2G.
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.