
Thermo Fisher Scientific MYOZ1 Polyclonal Antibody
MYOZ1 단백질 검출용 Thermo Fisher Scientific의 토끼 폴리클로날 항체. Western blot에 적합하며 인간 MYOZ1 N-말단 펩타이드(aa 71-120)를 면역원으로 제작됨. 고순도 친화 크로마토그래피 정제, 액상 형태로 제공, -20°C 보관.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.2–1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide directed towards the N-terminal of human MYOZ1 (aa 71–120) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS with 2% sucrose |
| Contains | 0.09% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2577121 |
Product Specific Information
Peptide sequence:
IYENHPDVFSDSSMDHFQKFLPTVGGQLGTAGQGFSYSKSNGRGGSQAGG
Sequence homology:
Cow: 86%
Dog: 100%
Guinea Pig: 100%
Horse: 100%
Human: 100%
Mouse: 100%
Rabbit: 100%
Rat: 100%
Target Information
Sarcomere assembly is regulated by the muscle protein titin. Titin is a giant elastic protein with kinase activity that extends half the length of a sarcomere. It serves as a scaffold to which myofibrils and other muscle-related proteins are attached. This gene encodes a protein found in striated and cardiac muscle that binds to the titin Z1–Z2 domains and is a substrate of titin kinase, interactions thought to be critical to sarcomere assembly. Mutations in this gene are associated with limb-girdle muscular dystrophy type 2G.
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific EPSTI1 Polyclonal Antibody
630,500원

Thermo Fisher Scientific
Thermo Fisher Scientific THOC6 Polyclonal Antibody
630,500원

Thermo Fisher Scientific
Thermo Fisher Scientific MYOZ1 Polyclonal Antibody
630,500원

Thermo Fisher Scientific
Thermo Fisher Scientific LZTFL1 Polyclonal Antibody
630,500원

Thermo Fisher Scientific
Thermo Fisher Scientific OCIAD1 Polyclonal Antibody
630,500원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|