CacheBy
Thermo Fisher Scientific WNT7A Polyclonal Antibody
원본

Thermo Fisher Scientific WNT7A Polyclonal Antibody

상품 한눈에 보기

Human, Mouse, Rat 반응성의 Rabbit Polyclonal WNT7A 항체로 Western blot에 적합. 항원 친화 크로마토그래피로 정제된 Lyophilized 형태이며 PBS+trehalose buffer에 보관. Wnt7a 신호전달 연구 및 암 관련 기전 연구용.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 03. 오후 10:50
Thermo Fisher Scientific PA580231 WNT7A Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific WNT7A Polyclonal Antibody

Applications

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Published Species Mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Synthetic peptide corresponding to a sequence at the C-terminus of human Wnt7a (226–256aa YVLKDKYNEAVHVEPVRASRNKRPTFLKIKK)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 4 mg trehalose
Contains No preservative
Storage Conditions -20°C
Shipping Conditions Wet ice
RRID AB_2747345

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

Wnt-7a는 배아 및 성체 조직의 항상성 유지에 핵심적인 역할을 하는 Wnt 신호 단백질군에 속합니다. 태반, 신장, 고환, 자궁, 태아 폐, 태아 및 성체 뇌에서 발현됩니다. 대부분의 Wnt 단백질은 canonical Wnt 경로를 통해 신호를 전달하며, Frizzled 수용체에 결합해 β-catenin 분해를 억제합니다. β-catenin이 세포 내에 축적되면 핵으로 이동해 TCF/LEF 전사인자와 결합하여 다양한 유전자의 발현을 유도합니다. Wnt/β-catenin 신호의 증가가 여러 암에서 종양 형성과 관련이 있지만, Wnt-7a/Frizzled-9 신호는 비소세포성 폐암에서 종양 억제 인자로 작용하는 것으로 알려져 있습니다.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

PA5-80231_WNT7A_O00755-1_Rabbit.svg
PA5-80231_WNT7A_O00755-1_Rabbit_PDP.jpeg

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.