
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DCTPP1 Antibody
상품 한눈에 보기
Human DCTPP1 단백질을 인식하는 토끼 유래 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합함. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. Recombinant expression 검증 완료.
- 카탈로그번호
- HPA002832-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA002832-100 Anti-DCTPP1 Antibody, dCTP pyrophosphatase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA002832-25 Anti-DCTPP1 Antibody, dCTP pyrophosphatase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DCTPP1 Antibody
Anti-DCTPP1 Antibody
Target: dCTP pyrophosphatase 1
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression Validation)
- ICC (Immunocytochemistry)
Recombinant expression validation:
Validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against human DCTPP1.
Alternative Gene Names
CDA03, MGC5627, RS21C6, XTP3TPA
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | dCTP pyrophosphatase 1 |
| Target Gene | DCTPP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000042462 (80%), Rat ENSRNOG00000017850 (78%) |
Antigen Sequence:
RLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDS
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



