
Atlas Antibodies Anti-DCHS1 Antibody
상품 한눈에 보기
휴먼 DCHS1 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 분석에 적합합니다. Rabbit에서 생산되었으며, PrEST 항원을 이용해 친화 정제되었습니다. 높은 종간 서열 보존성을 가지며, 다양한 연구 응용에 활용 가능합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-DCHS1 Antibody
Target: dachsous cadherin-related 1 (DCHS1)
Product Type: Polyclonal Antibody against Human DCHS1
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
This polyclonal antibody is produced in rabbit and specifically targets the human DCHS1 protein. It is affinity purified using the PrEST antigen as the affinity ligand.
Alternative Gene Names
CDH25, CDHR6, FIB1, FLJ11790, KIAA1773, PCDH16
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | dachsous cadherin-related 1 |
| Target Gene | DCHS1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | HSSGRGSAEAAEDDEIRMINEFPRVASVASSLAARGPDSGIQQDADGLSDTSCEPPAPDTWYKGRKAGLLLPGAGATLYREEGPPATATAFLGGCGLSPAPTGDYGFPADGKPCVAGALTAIVAGEEELRGSYNWDYLLSWCPQFQPLAS |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to orthologs:
- Rat ENSRNOG00000031643 (100%)
- Mouse ENSMUSG00000036862 (99%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-DCHS1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DCHS2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DCHS1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DCDC2C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DCDC2B Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.