
Atlas Antibodies Anti-DCAF7 Antibody
상품 한눈에 보기
Human DCAF7 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제된 고품질 항체이며, Human에 검증됨. DDB1 및 CUL4 관련 인자 연구에 유용.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-DCAF7 Antibody
DDB1 and CUL4 associated factor 7
Recommended Applications
- IHC (Independent antibody validation)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Validation of protein expression in IHC
Independent antibodies targeting different epitopes of the protein were compared to validate expression.
Product Description
Polyclonal Antibody against Human DCAF7
Alternative Gene Names
HAN11, SWAN-1, WDR68
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | DDB1 and CUL4 associated factor 7 |
| Target Gene | DCAF7 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | PCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNC |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000042245 (100%), Mouse ENSMUSG00000049354 (100%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-DCAF8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DCAF17 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DCAF7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DCAF5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DCAF6 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.