Atlas Antibodies Anti-DCAF7 Antibody

상품 한눈에 보기

Human DCAF7 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제된 고품질 항체이며, Human에 검증됨. DDB1 및 CUL4 관련 인자 연구에 유용.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA022962-100 Anti-DCAF7 Antibody, DDB1 and CUL4 associated factor 7 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA022962-25 Anti-DCAF7 Antibody, DDB1 and CUL4 associated factor 7 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

DDB1 and CUL4 associated factor 7

Validation of protein expression in IHC
Independent antibodies targeting different epitopes of the protein were compared to validate expression.

Polyclonal Antibody against Human DCAF7

HAN11, SWAN-1, WDR68

항목	내용
Target Protein	DDB1 and CUL4 associated factor 7
Target Gene	DCAF7
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	PCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNC
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000042245 (100%), Mouse ENSMUSG00000049354 (100%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand