CacheBy
Atlas Antibodies Anti-DBNL Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DBNL Antibody

상품 한눈에 보기

Human DBNL 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 검증됨. Orthogonal 및 Independent validation을 통해 높은 신뢰도의 단백질 발현 확인. Human, Mouse, Rat에 반응하며 PrEST 항원으로 친화 정제됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA020265-100 Anti-DBNL Antibody, drebrin-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020265-25 Anti-DBNL Antibody, drebrin-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DBNL Antibody

Anti-DBNL Antibody

drebrin-like

  • Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal Antibody against Human DBNL

Alternative Gene Names

HIP-55, SH3P7

Open Datasheet

Target Information

항목 내용
Target Protein drebrin-like
Target Gene DBNL
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence INWTGEGVNDVRKGACASHVSTMASFLKGAHVTINARAEEDVEPECIMEKVAKASGANYSFHKESGRFQDVGPQAPVGSVYQ

Verified Species Reactivity

Human, Mouse, Rat

Interspecies Information

유전자 ID 항원 서열 일치율
Rat ENSRNOG00000012378 95%
Mouse ENSMUSG00000020476 95%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
WB Independent Validation
Independent Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.