
Atlas Antibodies Anti-CYP4F2 Antibody
상품 한눈에 보기
인간 CYP4F2 단백질을 인식하는 토끼 폴리클로날 항체. IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 사람에 특이적으로 반응하며, 글리세롤 및 PBS 완충액에 보존됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CYP4F2 Antibody
Target: cytochrome P450, family 4, subfamily F, polypeptide 2 (CYP4F2)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human CYP4F2, generated using a recombinant PrEST antigen.
Target Information
- Target Protein: cytochrome P450, family 4, subfamily F, polypeptide 2
- Target Gene: CYP4F2
- Antigen Sequence:
RRNWFWGHQGMVNPTEEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPD
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000043344 | 70% |
| Mouse | ENSMUSG00000090700 | 68% |
Specifications
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet: Sodium Azide MSDS
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CYP7B1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CYR61 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CYP4F2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CYP4X1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CYP51A1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.