
Atlas Antibodies Anti-CYP2E1 Antibody
상품 한눈에 보기
Human CYP2E1 단백질을 인식하는 고품질 폴리클로날 항체. IHC 및 Western blot에 적합하며, RNA-seq 데이터 기반 정교한 Orthogonal 검증 완료. Rabbit 유래 IgG, PrEST 항원 친화 정제 방식으로 높은 특이성과 재현성 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CYP2E1 Antibody
Target: cytochrome P450, family 2, subfamily E, polypeptide 1
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고/저 발현 조직 간 검증 수행
- WB (Western Blot): 단백질 검출용으로 적합
Product Description
Polyclonal Antibody against Human CYP2E1
Alternative Gene Names
- CYP2E
Datasheet
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | cytochrome P450, family 2, subfamily E, polypeptide 1 |
| Target Gene | CYP2E1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Information | Rat ENSRNOG00000012458 (86%), Mouse ENSMUSG00000025479 (86%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
Antigen Sequence
EKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAG제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CYP2W1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CYP3A43 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CYP2E1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CYP2U1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CYP2R1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.