CacheBy
Atlas Antibodies Anti-CUZD1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CUZD1 Antibody

상품 한눈에 보기

Human CUZD1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC Orthogonal 검증을 통해 신뢰성 확보. Affinity 정제 방식으로 높은 특이도와 재현성을 제공하며, Human 시료에 적합. 연구용으로 CUZD1 단백질 발현 분석에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA068660-100 Anti-CUZD1 Antibody, CUB and zona pellucida-like domains 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA068660-25 Anti-CUZD1 Antibody, CUB and zona pellucida-like domains 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CUZD1 Antibody

Anti-CUZD1 Antibody

CUB and zona pellucida-like domains 1


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human CUZD1


Alternative Gene Names

ERG-1, UO-44

Open Datasheet


Target Information

항목 내용
Target Protein CUB and zona pellucida-like domains 1
Target Gene CUZD1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence QVSLRASDPNLVVFLDTCRASPTSDFASPTYDLIKSGCSRDETCKVYPLFGHYGRFQFNAFKFLRSMSSVYL
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000029945 (89%), Mouse ENSMUSG00000040205 (83%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.