
Atlas Antibodies Anti-CUEDC2 Antibody
상품 한눈에 보기
Human CUEDC2 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제. 재조합 발현 검증 완료. 사람에 특이적으로 반응하며 마우스 및 랫과 높은 상동성 보유.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CUEDC2 Antibody
CUE domain containing 2
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression Validation)
- ICC (Immunocytochemistry)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against human CUEDC2.
Alternative Gene Names
C10orf66, MGC2491
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | CUE domain containing 2 |
| Target Gene | CUEDC2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | DLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPI |
Species Reactivity
- Verified Species: Human
- Interspecies Information:
- Mouse ENSMUSG00000036748 (95%)
- Rat ENSRNOG00000019574 (75%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet (MSDS)
Notes
Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CTXN2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CUEDC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CUEDC2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CTSZ Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CTXN1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.