Atlas Antibodies Anti-CTSB Antibody

상품 한눈에 보기

Human CTSB(cathepsin B)를 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합. Orthogonal validation으로 RNA-seq 데이터와 비교 검증됨. PrEST 항원을 이용한 친화 정제 방식. 인간 단백질 발현 연구에 신뢰성 높은 선택.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA048998-100 Anti-CTSB Antibody, cathepsin B 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA048998-25 Anti-CTSB Antibody, cathepsin B 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CTSB Antibody

Anti-CTSB Antibody

Target: cathepsin B (CTSB)
Type: Polyclonal Antibody against Human CTSB
Supplier: Atlas Antibodies

Recommended Applications

IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
ICC (Immunocytochemistry)

Product Description

Polyclonal antibody generated in rabbit against human cathepsin B (CTSB).
Validated for use in immunohistochemistry and immunocytochemistry applications.

Open Datasheet

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence:
DELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPA

Species Reactivity

Verified Reactivity: Human
Interspecies Identity:
- Mouse (ENSMUSG00000021939) – 79%
- Rat (ENSRNOG00000010331) – 79%

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage	Gently mix before use. Store as recommended by supplier.
Notes	Optimal concentrations and conditions should be determined by the user.