
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CTRL Antibody
상품 한눈에 보기
Human CTRL 단백질을 표적으로 하는 rabbit polyclonal antibody로, IHC 및 WB 검증 완료. Recombinant protein 기반 PrEST 항원으로 제작되어 높은 특이성과 재현성을 제공. Orthogonal 및 recombinant expression validation을 통해 신뢰성 있는 단백질 발현 분석 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA034504-100 Anti-CTRL Antibody, chymotrypsin-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034504-25 Anti-CTRL Antibody, chymotrypsin-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CTRL Antibody
Anti-CTRL Antibody
Target: Chymotrypsin-like (CTRL)
Type: Polyclonal Antibody against Human CTRL
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data of high and low expression tissues.
- WB (Recombinant expression validation): Validation using target protein overexpression.
Product Description
Polyclonal antibody generated in rabbit against human chymotrypsin-like (CTRL).
Affinity purified using recombinant PrEST antigen as affinity ligand.
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | Chymotrypsin-like |
| Target Gene | CTRL |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | VTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLK |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (84%), Rat (84%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
| Safety Information | Material Safety Data Sheet |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



