
Atlas Antibodies Anti-CTRL Antibody
상품 한눈에 보기
Human CTRL 단백질을 표적으로 하는 rabbit polyclonal antibody로, IHC 및 WB 검증 완료. Recombinant protein 기반 PrEST 항원으로 제작되어 높은 특이성과 재현성을 제공. Orthogonal 및 recombinant expression validation을 통해 신뢰성 있는 단백질 발현 분석 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CTRL Antibody
Target: Chymotrypsin-like (CTRL)
Type: Polyclonal Antibody against Human CTRL
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data of high and low expression tissues.
- WB (Recombinant expression validation): Validation using target protein overexpression.
Product Description
Polyclonal antibody generated in rabbit against human chymotrypsin-like (CTRL).
Affinity purified using recombinant PrEST antigen as affinity ligand.
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | Chymotrypsin-like |
| Target Gene | CTRL |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | VTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLK |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (84%), Rat (84%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
| Safety Information | Material Safety Data Sheet |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
