
Atlas Antibodies Anti-CSPG4 Antibody
상품 한눈에 보기
Human CSPG4 단백질을 표적으로 하는 Rabbit Polyclonal 항체로, IHC 및 WB(Recombinant Expression) 검증 완료. Affinity purification 방식으로 높은 특이성과 재현성 제공. 다양한 CSPG4 관련 연구에 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CSPG4 Antibody
Target: chondroitin sulfate proteoglycan 4 (CSPG4)
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human CSPG4
Alternative Gene Names
HMW-MAA, MCSP, MCSPG, MEL-CSPG, MSK16, NG2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chondroitin sulfate proteoglycan 4 |
| Target Gene | CSPG4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | ILYEHEMPPEPFWEAHDTLELQLSSPPARDVAATLAVAVSFEAACPQRPSHLWKNKGLWVPEGQRARITVAALDASNLLASVPSPQRSEHDVLFQVTQFPSRGQLLVSEEPLHAGQPHFLQSQLAAGQLVYAHGGGGTQQDGFHFRAHL |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000032911 (87%)
- Rat ENSRNOG00000017208 (83%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CSPG4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CSPG4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CSPG4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CSNK2B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CSNK2A1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.