
Atlas Antibodies Anti-RNH1 Antibody
상품 한눈에 보기
Human RNH1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용한 친화정제 방식으로 높은 특이성과 재현성을 제공합니다. 인간 단백질 발현 검증에 독립적 항체 비교 검증을 거쳤습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RNH1 Antibody
Target: ribonuclease/angiogenin inhibitor 1 (RNH1)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry) – Validation of protein expression by comparing independent antibodies targeting different epitopes.
- WB (Western Blot) – Validation of protein expression by comparing independent antibodies targeting different epitopes.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human RNH1.
Alternative Gene Names
RAI, RNH
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ribonuclease/angiogenin inhibitor 1 |
| Target Gene | RNH1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | MSLDIQSLDIQCEELSDARWAELLPLLQQCQVVRLDDCGLTEARCKDISSALRVNPALAELNLRSNELGDVGVHCVLQGLQTPSCKIQKLSLQNCCLT |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000038650 (76%), Rat ENSRNOG00000016416 (76%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Open Datasheet (PDF)
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
