
Atlas Antibodies Anti-RNF217 Antibody
상품 한눈에 보기
인간 RNF217 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 Western Blot에 적합. PrEST 항원으로 친화 정제됨. 높은 종간 보존성(쥐, 생쥐 98%)을 보임. 40% 글리세롤/PBS 완충액에 보존제 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RNF217 Antibody
Target Protein: Ring finger protein 217 (RNF217)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human RNF217.
Alternative Gene Names
C6orf172, dJ84N20.1, IBRDC1, MGC26996
Antigen Information
- Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Epitope Sequence:
GQVEIKCPITECFEFLEETTVVYNLTHEDSIKYKYFLELGRIDSSTKPCPQCKHFTTFKK
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to orthologs:
- Rat (ENSRNOG00000013323): 98%
- Mouse (ENSMUSG00000063760): 98%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide |
| Preservative | Sodium azide (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-RNF219 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RNF216 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RNF217 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RNF216 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RNF215 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.