
Atlas Antibodies Anti-RNF141 Antibody
상품 한눈에 보기
Human RNF141 단백질을 타깃으로 하는 rabbit polyclonal antibody로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용해 친화정제되었으며, 재조합 발현 검증을 통해 신뢰성을 확보했습니다. Human에 반응하며 높은 종간 보존성을 보입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RNF141 Antibody
Target: ring finger protein 141 (RNF141)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) – Recombinant expression validation using target protein overexpression
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human RNF141.
Alternative Gene Names
- ZFP26
- ZNF230
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ring finger protein 141 |
| Target Gene | RNF141 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000030788 (99%), Rat ENSRNOG00000017900 (97%) |
Antigen Sequence:
QLVINKLPEKVAKHVTLVRESGSLTYEEFLGRVAELNDVTAKVASGQEKHLLFEVQPGSDSSAFWKVVVRVVCTKINKSSGIVEASRIMNLYQFIQLYKDITSQAAGVLAQSSTSEEPDENSSSVTSCQASLWMGRVKQLTDE
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide (preservative) |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-RNF146 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RNF145 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RNF141 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RNF144A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RNF144B Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.