Atlas Antibodies Anti-RNF10 Antibody

상품 한눈에 보기

Human RNF10 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합. PrEST 항원을 이용해 Affinity 정제됨. 높은 종간 보존성(마우스·랫 99%)을 보이며, 40% glycerol/PBS buffer에 보존됨.

카탈로그번호: HPA052643-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA052643-100 Anti-RNF10 Antibody, ring finger protein 10 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA052643-25 Anti-RNF10 Antibody, ring finger protein 10 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-RNF10 Antibody

Anti-RNF10 Antibody

Target Protein: Ring Finger Protein 10 (RNF10)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG

Recommended Applications

IHC (Immunohistochemistry)
WB (Western Blot)

Product Description

Polyclonal antibody against human RNF10.

Alternative Gene Names: KIAA0262, RIE2
Target Gene: RNF10

Open Datasheet

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:
SPCYYFYQAEDGQHMFLHPVNVRCLVREYGSLERSPEKISATVVEIAGYSMSEDVRQRHRYLSHLPLTCEFSICELALQPPVV

Verified Species Reactivity

Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000041740 (99%)
Rat ENSRNOG00000001172 (99%)

Specifications

항목	내용
Host	Rabbit
Clonality	Polyclonal
Isotype	IgG
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Storage	Gently mix before use. Store according to manufacturer’s instructions.
Notes	Optimal concentrations and conditions for each application should be determined by the user.