
Atlas Antibodies Anti-RNF10 Antibody
Human RNF10 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합. PrEST 항원을 이용해 Affinity 정제됨. 높은 종간 보존성(마우스·랫 99%)을 보이며, 40% glycerol/PBS buffer에 보존됨.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RNF10 Antibody
Target Protein: Ring Finger Protein 10 (RNF10)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
Product Description
Polyclonal antibody against human RNF10.
Alternative Gene Names: KIAA0262, RIE2
Target Gene: RNF10
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:
SPCYYFYQAEDGQHMFLHPVNVRCLVREYGSLERSPEKISATVVEIAGYSMSEDVRQRHRYLSHLPLTCEFSICELALQPPVV
Verified Species Reactivity
- Human
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000041740 (99%)
- Rat ENSRNOG00000001172 (99%)
Specifications
| 항목 | 내용 |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Storage | Gently mix before use. Store according to manufacturer’s instructions. |
| Notes | Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-RND3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RNF113A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RNF10 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RNF103 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RNF111 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|