
Atlas Antibodies Anti-RHBDD2 Antibody
상품 한눈에 보기
Human RHBDD2 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC에 적합합니다. 재조합 발현 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 40% 글리세롤 및 PBS 완충액에 보존됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RHBDD2 Antibody
Target: rhomboid domain containing 2 (RHBDD2)
Type: Polyclonal Antibody against Human RHBDD2
Supplier: Atlas Antibodies
Recommended Applications
- WB (Recombinant Expression Validation): 검증된 재조합 발현 기반 Western Blot
- ICC (Immunocytochemistry): 세포 내 단백질 발현 분석에 적합
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody raised in rabbit against human RHBDD2 protein.
Alternative Gene Names
- NPD007
- RHBDL7
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | rhomboid domain containing 2 |
| Target Gene | RHBDD2 |
| Antigen Sequence | HMPTLPPYQPASGLCYVQNHFGPNPTSSSVYPASAGTSLGIQPPTPVNSPGTVYSGALGTPGAAGSKESSRVP |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000039917 (84%), Rat ENSRNOG00000001443 (79%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야별 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-RHBG Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RHBDL3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RHBDD2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RHBDL2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RHBDL1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.