Atlas Antibodies Anti-RHBDD2 Antibody

상품 한눈에 보기

Human RHBDD2 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC에 적합합니다. 재조합 발현 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 40% 글리세롤 및 PBS 완충액에 보존됩니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA045074-100 Anti-RHBDD2 Antibody, rhomboid domain containing 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA045074-25 Anti-RHBDD2 Antibody, rhomboid domain containing 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: rhomboid domain containing 2 (RHBDD2)
Type: Polyclonal Antibody against Human RHBDD2
Supplier: Atlas Antibodies

Recombinant expression validation in WB using target protein overexpression.

Polyclonal antibody raised in rabbit against human RHBDD2 protein.

항목	내용
Target Protein	rhomboid domain containing 2
Target Gene	RHBDD2
Antigen Sequence	HMPTLPPYQPASGLCYVQNHFGPNPTSSSVYPASAGTSLGIQPPTPVNSPGTVYSGALGTPGAAGSKESSRVP
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000039917 (84%), Rat ENSRNOG00000001443 (79%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)