
Atlas Antibodies Anti-RECQL5 Antibody
상품 한눈에 보기
인체 RECQL5 단백질을 표적으로 하는 폴리클로날 항체. IHC, WB, ICC 실험에 적합하며 siRNA 노크다운으로 유전적 검증 완료. 토끼 유래 IgG 항체로 PrEST 항원 친화 정제. 휴먼에 반응하며 높은 특이성과 재현성을 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RECQL5 Antibody
RecQ protein-like 5
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Genetic validation by siRNA knockdown
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human RECQL5.
Alternative Gene Names
FLJ90603, RecQ5
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | RecQ protein-like 5 |
| Target Gene | RECQL5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | ELEHETFRNAKVANLYKASVLKKVADIHRASKDGQPYDMGGSAKSCSAQAEPPEPNEYDIPPASHVYSLKPKRVGAGFPKGSCPFQTATELMETTRIREQ |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (73%), Rat (72%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-REEP4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-REEP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RECQL5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-REEP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-REEP2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.