CacheBy
Atlas Antibodies Anti-RCBTB1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RCBTB1 Antibody

상품 한눈에 보기

Human RCBTB1 단백질을 인식하는 Rabbit Polyclonal 항체로, RCC1 및 BTB 도메인 단백질 연구에 적합합니다. Affinity purification 방식으로 정제되었으며, 다양한 응용에 사용 가능합니다. Human에 대한 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056783-100 Anti-RCBTB1 Antibody, regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056783-25 Anti-RCBTB1 Antibody, regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RCBTB1 Antibody

Anti-RCBTB1 Antibody

Target: Regulator of Chromosome Condensation (RCC1) and BTB (POZ) Domain Containing Protein 1
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human RCBTB1.


Alternative Gene Names

CLLD7, CLLL7, FLJ10716

Open Datasheet (PDF)


Target Information

  • Target Protein: Regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 1
  • Target Gene: RCBTB1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    RCEHFRSMFQSYWNEDMKEVIEIDQFSYPVY

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000035469 (100%)
  • Rat ENSRNOG00000021712 (100%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.