Atlas Antibodies Anti-RCBTB1 Antibody
| 상품 옵션 정보 | ||||||||
|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA056783-100 | - | Atlas Antibodies HPA056783-100 Anti-RCBTB1 Antibody, regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 1 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA056783-25 | - | Atlas Antibodies HPA056783-25 Anti-RCBTB1 Antibody, regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 1 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-RCBTB1 Antibody
regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 1
Recommended Applications
Product Description
Polyclonal Antibody against Human RCBTB1
Alternative Gene Names
CLLD7, CLLL7, FLJ10716
Target Protein
regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 1
Target Gene
RCBTB1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
RCEHFRSMFQSYWNEDMKEVIEIDQFSYPVY
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000035469 (100%)
Rat ENSRNOG00000021712 (100%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|