
Atlas Antibodies Anti-RCBTB1 Antibody
상품 한눈에 보기
Human RCBTB1 단백질을 인식하는 Rabbit Polyclonal 항체로, RCC1 및 BTB 도메인 단백질 연구에 적합합니다. Affinity purification 방식으로 정제되었으며, 다양한 응용에 사용 가능합니다. Human에 대한 반응성이 검증되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RCBTB1 Antibody
Target: Regulator of Chromosome Condensation (RCC1) and BTB (POZ) Domain Containing Protein 1
Supplier: Atlas Antibodies
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human RCBTB1.
Alternative Gene Names
CLLD7, CLLL7, FLJ10716
Target Information
- Target Protein: Regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 1
- Target Gene: RCBTB1
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
RCEHFRSMFQSYWNEDMKEVIEIDQFSYPVY
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000035469 (100%)
- Rat ENSRNOG00000021712 (100%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-RCBTB2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RCAN3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RCBTB1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RCAN3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RCAN2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.