
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-RCBTB1 Antibody
상품 한눈에 보기
Human RCBTB1 단백질을 인식하는 Rabbit Polyclonal 항체로, RCC1 및 BTB 도메인 단백질 연구에 적합합니다. Affinity purification 방식으로 정제되었으며, 다양한 응용에 사용 가능합니다. Human에 대한 반응성이 검증되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA056783-100 Anti-RCBTB1 Antibody, regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056783-25 Anti-RCBTB1 Antibody, regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-RCBTB1 Antibody
Anti-RCBTB1 Antibody
Target: Regulator of Chromosome Condensation (RCC1) and BTB (POZ) Domain Containing Protein 1
Supplier: Atlas Antibodies
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human RCBTB1.
Alternative Gene Names
CLLD7, CLLL7, FLJ10716
Target Information
- Target Protein: Regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 1
- Target Gene: RCBTB1
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
RCEHFRSMFQSYWNEDMKEVIEIDQFSYPVY
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000035469 (100%)
- Rat ENSRNOG00000021712 (100%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



