
Atlas Antibodies Anti-RBMS1 Antibody
상품 한눈에 보기
Human RBMS1 단백질을 인식하는 토끼 폴리클로날 항체로, RNA 결합 단백질 연구에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 인간에 대해 검증되었으며, 다양한 응용에 사용할 수 있습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RBMS1 Antibody
Target: RNA binding motif, single stranded interacting protein 1 (RBMS1)
Supplier: Atlas Antibodies
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human RBMS1.
Alternative Gene Names
C2orf12, DKFZp564H0764, HCC-4, MSSP-1, MSSP-2, MSSP-3, SCR2, YC1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | RNA binding motif, single stranded interacting protein 1 |
| Target Gene | RBMS1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | GSTGTYMPATSAMQGAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQPNK |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (95%), Rat (91%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
