CacheBy
Atlas Antibodies Anti-RBMS1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RBMS1 Antibody

상품 한눈에 보기

Human RBMS1 단백질을 인식하는 토끼 폴리클로날 항체로, RNA 결합 단백질 연구에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 인간에 대해 검증되었으며, 다양한 응용에 사용할 수 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061791-100 Anti-RBMS1 Antibody, RNA binding motif, single stranded interacting protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061791-25 Anti-RBMS1 Antibody, RNA binding motif, single stranded interacting protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RBMS1 Antibody

Anti-RBMS1 Antibody

Target: RNA binding motif, single stranded interacting protein 1 (RBMS1)
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human RBMS1.


Alternative Gene Names

C2orf12, DKFZp564H0764, HCC-4, MSSP-1, MSSP-2, MSSP-3, SCR2, YC1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein RNA binding motif, single stranded interacting protein 1
Target Gene RBMS1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GSTGTYMPATSAMQGAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQPNK
Verified Species Reactivity Human
Interspecies Identity Mouse (95%), Rat (91%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.