CacheBy
Thermo Fisher Scientific MUC2 Polyclonal Antibody
원본

Thermo Fisher Scientific MUC2 Polyclonal Antibody

상품 한눈에 보기

Thermo Fisher Scientific의 MUC2 Polyclonal Antibody는 인간, 마우스, 랫트 시료에 반응하며 IHC 등 다양한 응용에 적합합니다. 항원 친화 크로마토그래피로 정제된 비결합형 항체로, 장 점액소 MUC2 단백질 연구에 이상적입니다. 연구용으로만 사용됩니다.

카탈로그번호
PA579702
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 03:38
Thermo Fisher Scientific PA579702 MUC2 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific MUC2 Polyclonal Antibody

Applications

Application Tested Dilution Publications
Immunohistochemistry (IHC) - View 4 publications
Immunohistochemistry (Paraffin) (IHC (P)) 2–5 µg/mL View 1 publication
Immunohistochemistry (PFA fixed) (IHC (PFA)) - View 1 publication

Product Specifications

Specification Description
Species Reactivity Human, Mouse, Rat
Published Species Horse, Human, Mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence of human MUC2 (DDFKTASGLVEATGAGFANTWKAQSTCHDKLDWLDD)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 4 mg trehalose
Contains 0.05 mg sodium azide
Storage Conditions -20°C
Shipping Conditions Wet ice
RRID AB_2746817

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.


Target Information

Secreted epithelial mucins are large macromolecules which exhibit extreme polydispersity.
Mucin 2 (MUC2) is the major intestinal mucin.
O-glycans are attached to MUC2 in a potentially diverse arrangement, which is crucial for their interaction with endogenous and exogenous lectins.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.