원본
Thermo Fisher Scientific MUC2 Polyclonal Antibody
상품 한눈에 보기
Thermo Fisher Scientific의 MUC2 Polyclonal Antibody는 인간, 마우스, 랫트 시료에 반응하며 IHC 등 다양한 응용에 적합합니다. 항원 친화 크로마토그래피로 정제된 비결합형 항체로, 장 점액소 MUC2 단백질 연구에 이상적입니다. 연구용으로만 사용됩니다.
- 카탈로그번호
- PA579702
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 03:38
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579702 MUC2 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific MUC2 Polyclonal Antibody
Applications
| Application | Tested Dilution | Publications |
|---|---|---|
| Immunohistochemistry (IHC) | - | View 4 publications |
| Immunohistochemistry (Paraffin) (IHC (P)) | 2–5 µg/mL | View 1 publication |
| Immunohistochemistry (PFA fixed) (IHC (PFA)) | - | View 1 publication |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Horse, Human, Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human MUC2 (DDFKTASGLVEATGAGFANTWKAQSTCHDKLDWLDD) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746817 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Secreted epithelial mucins are large macromolecules which exhibit extreme polydispersity.
Mucin 2 (MUC2) is the major intestinal mucin.
O-glycans are attached to MUC2 in a potentially diverse arrangement, which is crucial for their interaction with endogenous and exogenous lectins.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific MUC6 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific MVD Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific MUC7 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific MUC5AC Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.