Thermo Fisher Scientific MUC2 Polyclonal Antibody
Thermo Fisher Scientific의 MUC2 Polyclonal Antibody는 인간, 마우스, 랫트 시료에 반응하며 IHC 등 다양한 응용에 적합합니다. 항원 친화 크로마토그래피로 정제된 비결합형 항체로, 장 점액소 MUC2 단백질 연구에 이상적입니다. 연구용으로만 사용됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
| Application | Tested Dilution | Publications |
|---|---|---|
| Immunohistochemistry (IHC) | - | View 4 publications |
| Immunohistochemistry (Paraffin) (IHC (P)) | 2–5 µg/mL | View 1 publication |
| Immunohistochemistry (PFA fixed) (IHC (PFA)) | - | View 1 publication |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Horse, Human, Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human MUC2 (DDFKTASGLVEATGAGFANTWKAQSTCHDKLDWLDD) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746817 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Secreted epithelial mucins are large macromolecules which exhibit extreme polydispersity.
Mucin 2 (MUC2) is the major intestinal mucin.
O-glycans are attached to MUC2 in a potentially diverse arrangement, which is crucial for their interaction with endogenous and exogenous lectins.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific MUC6 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MVD Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MUC2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MUC7 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MUC5AC Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|