
Thermo Fisher Scientific PML Polyclonal Antibody
PML 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody로, WB 및 IHC(P) 실험에 적합. 항원 친화 크로마토그래피로 정제되었으며, Lyophilized 형태로 제공. 인간 및 마우스 시료 반응, 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific PML Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| Specification | Details |
|---|---|
| Species Reactivity | Human, Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to sequence at N-terminus of mouse PML Protein (140–177aa LADFWCFECEQLICSKCFEAHQWYLKHEARPLADLRDN) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746951 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, involved in nucleotide excision repair (NER). It interacts with and enhances the activity of 3-methyladenine-DNA glycosylase (MPG), suggesting a role in DNA damage recognition during base excision repair.
This protein contains an N-terminal ubiquitin-like domain that interacts with the 26S proteasome and ubiquitin protein ligase E6AP, indicating involvement in the ubiquitin-mediated proteolytic pathway.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 파일: PA5-79836_PML_Q60953-1_Rabbit.svg, PA5-79836_PML_Q60953-1_Rabbit_PDP.jpeg)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific PML Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific PMVK Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific PML Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific PMS2 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific PLTP Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|