Atlas Antibodies Anti-RBM15B Antibody

상품 한눈에 보기

Human RBM15B 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합. Affinity purification 방식으로 제조되었으며, 높은 종간 보존성과 신뢰성 있는 결과 제공. 연구용으로 다양한 RNA 결합 단백질 분석에 활용 가능.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036645-100 Anti-RBM15B Antibody, RNA binding motif protein 15B 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036645-25 Anti-RBM15B Antibody, RNA binding motif protein 15B 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-RBM15B Antibody

Anti-RBM15B Antibody

Target Protein: RNA binding motif protein 15B
Supplier: Atlas Antibodies

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)
Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human RBM15B.

Alternative Gene Names

HUMAGCGB, OTT3

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	RNA binding motif protein 15B
Target Gene	RBM15B
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	GKKARDSERNHRTTEAEPKPLEEPKHETKKLKNLSEYAQTLQLGWNGLLVLKNSCFPTSMHILEGDQGVISSLLKDHTSG

Verified Species Reactivity

Human

Interspecies Information

종	Ortholog ID	Sequence Identity
Rat	ENSRNOG00000014161	94%
Mouse	ENSMUSG00000074102	93%

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)