
Atlas Antibodies Anti-RBM15B Antibody
상품 한눈에 보기
Human RBM15B 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합. Affinity purification 방식으로 제조되었으며, 높은 종간 보존성과 신뢰성 있는 결과 제공. 연구용으로 다양한 RNA 결합 단백질 분석에 활용 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RBM15B Antibody
Target Protein: RNA binding motif protein 15B
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human RBM15B.
Alternative Gene Names
HUMAGCGB, OTT3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | RNA binding motif protein 15B |
| Target Gene | RBM15B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GKKARDSERNHRTTEAEPKPLEEPKHETKKLKNLSEYAQTLQLGWNGLLVLKNSCFPTSMHILEGDQGVISSLLKDHTSG |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000014161 | 94% |
| Mouse | ENSMUSG00000074102 | 93% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-RBM15B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RBM15 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RBM15B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RBM15 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RBM14 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.