CacheBy
Atlas Antibodies Anti-RBM15B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RBM15B Antibody

상품 한눈에 보기

Human RBM15B 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합. Affinity purification 방식으로 제조되었으며, 높은 종간 보존성과 신뢰성 있는 결과 제공. 연구용으로 다양한 RNA 결합 단백질 분석에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036645-100 Anti-RBM15B Antibody, RNA binding motif protein 15B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036645-25 Anti-RBM15B Antibody, RNA binding motif protein 15B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RBM15B Antibody

Anti-RBM15B Antibody

Target Protein: RNA binding motif protein 15B
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human RBM15B.


Alternative Gene Names

HUMAGCGB, OTT3

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein RNA binding motif protein 15B
Target Gene RBM15B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence GKKARDSERNHRTTEAEPKPLEEPKHETKKLKNLSEYAQTLQLGWNGLLVLKNSCFPTSMHILEGDQGVISSLLKDHTSG

Verified Species Reactivity

  • Human

Interspecies Information

Ortholog ID Sequence Identity
Rat ENSRNOG00000014161 94%
Mouse ENSMUSG00000074102 93%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.