
Atlas Antibodies Anti-RBM12 Antibody
상품 한눈에 보기
인간 RBM12 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. 토끼 유래 IgG 형이며 PrEST 항원을 이용해 친화 정제되었습니다. 인간, 마우스, 랫트에서 교차 반응성이 검증되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RBM12 Antibody
RNA Binding Motif Protein 12
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Independent validation using different epitopes
- Immunocytochemistry (ICC)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human RBM12
Alternative Gene Names
HRIHFB2091, KIAA0765, SWAN
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | RNA binding motif protein 12 |
| Target Gene | RBM12 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GSGAPMNLNNNLNPMFLGPLNPVNPIQMNSQSSVKPLPINPDDLYVSVHGMPFSAMENDVRDFFHGLRVDAVHLLKDHVGRNNGNGLV |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Rat ENSRNOG00000019723 (94%), Mouse ENSMUSG00000098950 (92%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-RBM15 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RBM14 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RBM12 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RBM12B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RBM12 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.