
Atlas Antibodies Anti-RANGAP1 Antibody
인간 RANGAP1 단백질을 인식하는 폴리클로날 항체로, WB, IHC, ICC 등 다양한 응용에 적합함. 토끼 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. 높은 종간 서열 일치율을 보여 인간, 마우스, 랫트에서 활용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RANGAP1 Antibody
Target: Ran GTPase activating protein 1
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Independent Validation)
- Immunocytochemistry (ICC)
Independent Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human RANGAP1.
Alternative Gene Names
Fug1, KIAA1835, SD
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Ran GTPase activating protein 1 |
| Target Gene | RANGAP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000022391 (96%), Rat ENSRNOG00000031789 (95%) |
Antigen Sequence:
ETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPALISLGE
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes:
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-RAP1GAP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RANGAP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RANGAP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RANBP3L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RANBP3L Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|