CacheBy
Atlas Antibodies Anti-RALGPS2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RALGPS2 Antibody

상품 한눈에 보기

Human RALGPS2 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형태입니다. IHC 및 WB 실험에 적합하며, RNA-seq 데이터 기반의 Orthogonal validation으로 검증되었습니다. 고순도 Affinity 정제 방식으로 제조되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027143-100 Anti-RALGPS2 Antibody, Ral GEF with PH domain and SH3 binding motif 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027143-25 Anti-RALGPS2 Antibody, Ral GEF with PH domain and SH3 binding motif 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RALGPS2 Antibody

Anti-RALGPS2 Antibody

Ral GEF with PH domain and SH3 binding motif 2


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Applicable for: IHC (Orthogonal validation), WB


Product Description

Polyclonal antibody against Human RALGPS2


Alternative Gene Names

FLJ10244, FLJ25604, KIAA0351

Open Datasheet


Target Information

항목 내용
Target Protein Ral GEF with PH domain and SH3 binding motif 2
Target Gene RALGPS2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence STLSSGISIGSSDGSELSEETSWPAFERNRLYHSLGPVTRVARNGYRSHMKASSSAESEDLAVHLYPGAVTIQGVLR
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000026594 (97%), Rat ENSRNOG00000004736 (97%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
Western Blot

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.