
Atlas Antibodies Anti-RAD23B Antibody
상품 한눈에 보기
Human RAD23B 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며, 인간에서 검증되었습니다. 단백질 발현 검증에 독립 항체 비교 방식을 적용했습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RAD23B Antibody
RAD23 homolog B (S. cerevisiae)
Recommended Applications
- IHC (Independent antibody validation)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Validation Note:
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human RAD23B.
Alternative Gene Names
HHR23B, HR23B, P58
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | RAD23 homolog B (S. cerevisiae) |
| Target Gene | RAD23B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | VIEALRASFNNPDRAVEYLLMGIPGDRESQAVVDPPQAASTGAPQSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNP |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000016137 (93%), Mouse ENSMUSG00000028426 (93%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-RAD51B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RAD51AP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RAD23B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RAD50 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RAD21 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.