CacheBy
Atlas Antibodies Anti-RAD23B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RAD23B Antibody

상품 한눈에 보기

Human RAD23B 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며, 인간에서 검증되었습니다. 단백질 발현 검증에 독립 항체 비교 방식을 적용했습니다.

카탈로그번호
HPA029720-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA029720-100 Anti-RAD23B Antibody, RAD23 homolog B (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029720-25 Anti-RAD23B Antibody, RAD23 homolog B (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RAD23B Antibody

Anti-RAD23B Antibody

RAD23 homolog B (S. cerevisiae)


  • IHC (Independent antibody validation)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Validation Note:
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal antibody against human RAD23B.


Alternative Gene Names

HHR23B, HR23B, P58


Target Information

항목 내용
Target Protein RAD23 homolog B (S. cerevisiae)
Target Gene RAD23B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence VIEALRASFNNPDRAVEYLLMGIPGDRESQAVVDPPQAASTGAPQSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNP
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000016137 (93%), Mouse ENSMUSG00000028426 (93%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Independent Validation
Independent Validation Tooltip
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.