
Atlas Antibodies Anti-RAB14 Antibody
상품 한눈에 보기
Rabbit polyclonal anti-RAB14 antibody recognizing human RAB14 protein. Validated for IHC, WB, and ICC applications. Affinity purified using PrEST antigen. Supplied in PBS with 40% glycerol and 0.02% sodium azide preservative.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RAB14 Antibody
제품 설명
Polyclonal antibody against human RAB14, a member of the RAS oncogene family.
권장 애플리케이션
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
대체 유전자명
FBP, RAB-14
표적 정보
| 항목 | 내용 |
|---|---|
| Target Protein | RAB14, member RAS oncogene family |
| Target Gene | RAB14 |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000026878 (100%), Rat ENSRNOG00000018901 (100%) |
항원 정보
Antigen Sequence:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQ항체 특성
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
완충액 구성
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
주의사항
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 대한 최적 농도와 조건은 사용자가 직접 확인해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-RAB19 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RAB17 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RAB14 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RAB18 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RAB15 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.