CacheBy
Atlas Antibodies Anti-RAB14 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RAB14 Antibody

상품 한눈에 보기

Rabbit polyclonal anti-RAB14 antibody recognizing human RAB14 protein. Validated for IHC, WB, and ICC applications. Affinity purified using PrEST antigen. Supplied in PBS with 40% glycerol and 0.02% sodium azide preservative.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026419-100 Anti-RAB14 Antibody, RAB14, member RAS oncogene family 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026419-25 Anti-RAB14 Antibody, RAB14, member RAS oncogene family 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RAB14 Antibody

Anti-RAB14 Antibody

제품 설명

Polyclonal antibody against human RAB14, a member of the RAS oncogene family.

권장 애플리케이션

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

대체 유전자명

FBP, RAB-14

Open Datasheet

표적 정보

항목 내용
Target Protein RAB14, member RAS oncogene family
Target Gene RAB14
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000026878 (100%), Rat ENSRNOG00000018901 (100%)

항원 정보

Antigen Sequence:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

GQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQ

항체 특성

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

완충액 구성

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

주의사항

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 대한 최적 농도와 조건은 사용자가 직접 확인해야 합니다.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.