Atlas Antibodies Anti-PUF60 Antibody

상품 한눈에 보기

Human PUF60 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 WB에서 검증됨. Orthogonal 및 independent validation 수행. Affinity purification 방식으로 정제되어 높은 특이성과 재현성 제공. Human에 대한 반응성 확인.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA052096-100 Anti-PUF60 Antibody, poly-U binding splicing factor 60KDa 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA052096-25 Anti-PUF60 Antibody, poly-U binding splicing factor 60KDa 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-PUF60 Antibody

Anti-PUF60 Antibody

poly-U binding splicing factor 60KDa

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody against Human PUF60.

Alternative Gene Names

FIR, RoBPI, SIAHBP1

Open Datasheet

Target Information

항목	내용
Target Protein	poly-U binding splicing factor 60KDa
Target Gene	PUF60
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	AATAKITAQEAVAGAAVLGTLGTPGLVSPALTLAQPLGTLPQAVMAAQAPGVITGVTPARPPIPVTIPSVGVVNPILASPPTL

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000002524 (98%)
Rat ENSRNOG00000009960 (98%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet