
Atlas Antibodies Anti-PTGES Antibody
상품 한눈에 보기
Human PTGES 단백질을 표적으로 하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와의 일치성을 검증하였으며, 고순도 Affinity 정제 방식으로 생산되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PTGES Antibody
Target: Prostaglandin E synthase (PTGES)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. - WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. - ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human PTGES
Alternative Gene Names
MGST-IV, MGST1-L1, MGST1L1, PIG12, TP53I12
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Prostaglandin E synthase |
| Target Gene | PTGES |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | ITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAPRNDM |
Verified Species Reactivity
Human, Mouse
Interspecies Information
| 종 | Ortholog ID | 항원 서열 유사도 |
|---|---|---|
| Rat | ENSRNOG00000006320 | 91% |
| Mouse | ENSMUSG00000050737 | 86% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PTGFRN Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PTGES3L-AARSD1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PTGES Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PTGER4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PTGDS Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.