
Atlas Antibodies Anti-PSTPIP2 Antibody
상품 한눈에 보기
Human PSTPIP2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 Western blot에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었으며, 고순도의 Affinity purification 방식으로 제조되었습니다. Human, Mouse, Rat 반응성 확인됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PSTPIP2 Antibody
Target: proline-serine-threonine phosphatase interacting protein 2 (PSTPIP2)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. - WB (Western Blot)
Product Description
Polyclonal Antibody against Human PSTPIP2
Open Datasheet
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | proline-serine-threonine phosphatase interacting protein 2 |
| Target Gene | PSTPIP2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LVNPKQQEKLFVKLATSKTAVEDSDKAYMLHIGTLDKVREEWQSEHIKACEAFEAQECERINFFRNALWLHVNQLSQQC |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Rat ENSRNOG00000016987 (89%), Mouse ENSMUSG00000025429 (87%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PTBP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PTAFR Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PSTPIP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PSTK Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PSTPIP1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.