CacheBy
Atlas Antibodies Anti-CRIM1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CRIM1 Antibody

상품 한눈에 보기

Human CRIM1 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC Orthogonal 검증 완료. 고순도 Affinity purification 방식으로 제조되었으며, RNA-seq 데이터 기반 발현 비교 검증 제공. Human에 특이적 반응성을 가지며, 연구용으로 최적화됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA000556-100 Anti-CRIM1 Antibody, cysteine rich transmembrane BMP regulator 1 (chordin-like) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000556-25 Anti-CRIM1 Antibody, cysteine rich transmembrane BMP regulator 1 (chordin-like) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CRIM1 Antibody

Anti-CRIM1 Antibody

cysteine rich transmembrane BMP regulator 1 (chordin-like)


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human CRIM1


Alternative Gene Names

  • S52

Open Datasheet


Target Information

항목 내용
Target Protein cysteine rich transmembrane BMP regulator 1 (chordin-like)
Target Gene CRIM1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Antigen Sequence:

LTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNIINGKCECNTIRTCSNPFEFPSQDMCLSALKRIEEEKPDCSKARCEVQFSPRCPEDSVLIEGYAPPGECCPLP

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000024074 (88%)
  • Rat ENSRNOG00000004208 (88%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit

Buffer Composition

성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.