CacheBy
Atlas Antibodies Anti-CRABP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CRABP1 Antibody

상품 한눈에 보기

Human CRABP1 단백질을 인식하는 rabbit polyclonal antibody로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 보입니다. 40% glycerol 및 PBS buffer로 안정화되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA017203-100 Anti-CRABP1 Antibody, cellular retinoic acid binding protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017203-25 Anti-CRABP1 Antibody, cellular retinoic acid binding protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CRABP1 Antibody

Anti-CRABP1 Antibody

Target: Cellular Retinoic Acid Binding Protein 1 (CRABP1)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human CRABP1, designed for research applications such as immunohistochemistry (IHC).

Alternative Gene Names

CRABP, CRABP-I, CRABPI, RBP5

Open Datasheet


Target Information

항목 내용
Target Protein Cellular retinoic acid binding protein 1
Target Gene CRABP1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (ENSMUSG00000032291) 99%, Rat (ENSRNOG00000023633) 99%

Antigen Sequence:
QFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE


Antibody Information

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.