CacheBy
Atlas Antibodies Anti-CPZ Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CPZ Antibody

상품 한눈에 보기

인간 CPZ(carboxypeptidase Z)를 인식하는 폴리클로날 항체로, 토끼에서 생산된 IgG 형식입니다. PrEST 항원으로 친화 정제되었으며, 인체 반응성이 검증되었습니다. 면역세포화학 등 다양한 연구 응용에 적합합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA078608-100 Anti-CPZ Antibody, carboxypeptidase Z 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA078608-25 Anti-CPZ Antibody, carboxypeptidase Z 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CPZ Antibody

Anti-CPZ Antibody

Target Information

  • Target Protein: carboxypeptidase Z
  • Target Gene: CPZ
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    SYPFDFSKHPQEEKMFSPTPDEKMFKLLSRAYADVHPMMMDRSENRCGGNFLKRGSIINGADWYSFTGGMSDFNY

Product Description

Polyclonal Antibody against Human CPZ

Open Datasheet

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000008947 (97%)
  • Mouse ENSMUSG00000036596 (95%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

면역세포화학(ICC) 등 다양한 생명과학 연구 응용에 적합합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.