Atlas Antibodies Anti-CPVL Antibody

상품 한눈에 보기

Human CPVL 단백질에 대한 고특이성 폴리클로날 항체로, IHC 및 RNA-seq 데이터 비교를 통한 오쏘고날 검증 제공. Rabbit에서 생산된 IgG 형 항체이며, PrEST 항원으로 정제됨. 다양한 조직에서 단백질 발현 분석에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA045715-100 Anti-CPVL Antibody, carboxypeptidase, vitellogenic-like 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA045715-25 Anti-CPVL Antibody, carboxypeptidase, vitellogenic-like 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: carboxypeptidase, vitellogenic-like (CPVL)
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal Antibody against Human CPVL
Open Datasheet

항목	내용
Target Protein	carboxypeptidase, vitellogenic-like
Target Gene	CPVL
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	MNNYKVLIYNGQLDIIVAAALTERSLMGMDWKGSQEYKKAEKKVWKIFKSDSEVAGYIRQAGDFHQVIIRGGGHILPYDQPLRAFDMINRFIYGKGWDPYVG
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000052955 (79%), Rat ENSRNOG00000009172 (78%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.