CacheBy
Atlas Antibodies Anti-CR1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CR1 Antibody

상품 한눈에 보기

Human CR1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합. Orthogonal validation으로 RNA-seq 데이터와 단백질 발현 비교 검증. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042455-100 Anti-CR1 Antibody, complement component (3b/4b) receptor 1 (Knops blood group) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042455-25 Anti-CR1 Antibody, complement component (3b/4b) receptor 1 (Knops blood group) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CR1 Antibody

Anti-CR1 Antibody

Target: Complement component (3b/4b) receptor 1 (Knops blood group)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human CR1.


Alternative Gene Names

CD35, KN

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Complement component (3b/4b) receptor 1 (Knops blood group)
Target Gene CR1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence LIGSPSTTCLVSGNNVTWDKKAPICEIISCEPPPTISNGDFYSNNRTSFHNGTVVTYQCHTGPDGEQ

Verified Species Reactivity

Human


Interspecies Information

Ortholog ID 항원 서열 유사도
Mouse ENSMUSG00000026616 61%
Rat ENSRNOG00000008193 58%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.